50 µg
70R-1066
475 EUR
Raised in:
Rabbit
Concentration:
1 mg/ml
Tested for:
WB; IHC
Shipping conditions:
Blue Ice
French translation:
anticorps
Category:
Primary Antibody
Method of Purification:
Affinity Purified
Area of research:
Signal Transduction
Cross Reactivity:
Human, Mouse, Rat, Dog
Usage Recommendations:
WB: 1.25 ug/ml; IHC: 4-8 ug/ml
Antibody Subtype:
Polyclonal Antibodies, Purified
Specificity:
WNT2B antibody was raised against the middle region of WNT2B
Form & Buffer:
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT2B antibody in PBS
Storage:
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Properties:
If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
Assay Information:
WNT2B Blocking Peptide, catalog no. 33R-10585, is also available for use as a blocking control in assays to test for specificity of this WNT2B antibody
Type of Immunogen:
WNT2B antibodies were raised using the middle region of WNT2B corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT
Additional Information:
This is a rabbit polyclonal antibody against WNT2B. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com