LTC4S antibody

Tested for:

WB

Cross Reactivity:

Human

Raised in:

Rabbit

Concentration:

1 mg/ml

Shipping conditions:

Blue Ice

French translation:

anticorps

Usage Recommendations:

WB: 1-2.5 ug/ml

Category:

Primary Antibody

Method of Purification:

Affinity purified

Area of research:

Signal Transduction

Antibody Subtype:

Polyclonal Antibodies, Purified

Specificity:

LTC4S antibody was raised against the N terminal of LTC4S

Form & Buffer:

Lyophilized powder. Add 50 ul distilled water for a 1mg/ml concentration of LTC4S antibody in PBS

Storage:

Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Properties:

If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Type of Immunogen:

LTC4S antibodies were raised using the N terminal of LTC4S corresponding to a region with amino acids MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY

Additional Information:

This is a rabbit polyclonal antibody against LTC4S, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]