NR5A1 antibody

Tested for:

WB

Cross Reactivity:

Human

Raised in:

Rabbit

Concentration:

1 mg/ml

Shipping conditions:

Blue Ice

French translation:

anticorps

Usage Recommendations:

WB: 1 ug/ml

Area of research:

Cell Biology

Category:

Primary Antibody

Method of Purification:

Affinity Purified

Antibody Subtype:

Polyclonal Antibodies, Purified

Specificity:

NR5A1 antibody was raised against the middle region of NR5A1

Form & Buffer:

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NR5A1 antibody in PBS

Storage:

Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Properties:

If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Assay Information:

NR5A1 Blocking Peptide, catalog no. 33R-5322, is also available for use as a blocking control in assays to test for specificity of this NR5A1 antibody

Type of Immunogen:

NR5A1 antibodies were raised using the middle region of NR5A1 corresponding to a region with amino acids  LQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWA

Additional Information:

This is a rabbit polyclonal antibody against NR5A1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]