WNT2B antibody

Raised in:

Rabbit

Concentration:

1 mg/ml

Tested for:

WB; IHC

Shipping conditions:

Blue Ice

French translation:

anticorps

Category:

Primary Antibody

Method of Purification:

Affinity Purified

Area of research:

Signal Transduction

Cross Reactivity:

Human, Mouse, Rat, Dog

Usage Recommendations:

WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Antibody Subtype:

Polyclonal Antibodies, Purified

Specificity:

WNT2B antibody was raised against the middle region of WNT2B

Form & Buffer:

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT2B antibody in PBS

Storage:

Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Properties:

If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.

Assay Information:

WNT2B Blocking Peptide, catalog no. 33R-10585, is also available for use as a blocking control in assays to test for specificity of this WNT2B antibody

Type of Immunogen:

WNT2B antibodies were raised using the middle region of WNT2B corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT

Additional Information:

This is a rabbit polyclonal antibody against WNT2B. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]