Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha(FCER1A),partial

Gene number:

FCER1A

Protein origin:

E.coli

Use before:

1 year

Protein number:

P12319

Protein purity:

≥ 90%

Protein region:

26-205aa

Expected molecular weight:

37.02kDa

Shipping requirements:

Blue ice

Group:

recombinants

Estimated production time:

7-11 business days

Information about sequence:

Extracellular Domain

Verified reactivity:

Homo sapiens (Human)

Source:

Recombinants or rec. proteins

Notes:

For research use only. Not for diagnostic procedures.

Storage recommendation:

Aliquot and store at -20°C. Minimize freezing and thawing.

Other name:

c-epsilon RI-alpha; Short name:; FcERI; IgE Fc receptor subunit alpha

Test:

A high affinity purification column was use to purify Recombinant immunoglobulin epsilon receptor subunit alpha(FCER1A),partial by bioma by chromatographic size exclusion.

Protein sequence:

VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

Properties:

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Description:

The Recombinant immunoglobulin epsilon receptor subunit alpha(FCER1A),partial is a α- or alpha protein sometimes glycoprotein present in blood.The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.