Recombinant Mouse Low Affinity IgG Fc Receptor IV/FcgR4/CD16-2 (C-6His)

Additional isotype:

IgG

Estimated molecular weight:

21.9

Species reactivity:

Mouse

UniProt number:

Q8R2R4

Origin:

Human cells

Group:

recombinants

Latin name:

Mus musculus

Shipping condition:

Ambient/Room Temperature

Source:

Recombinants or rec. proteins

Protein purity:

Greater than 95% as determined by reducing SDS-PAGE.

Package form:

Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.

Endotoxin level:

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Peptide sequence:

GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYSQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQVDHHHHHH

Description:

Recombinant Mouse Low Affinity Immunoglobulin Gamma Fc Region Receptor IV is produced by our Mammalian expression system and the target gene encoding Gly21-Gln203 is expressed with a 6His tag at the C-terminus.

Storage conditions:

Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.

Reconstitution conditions:

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

About:

Immunoglobulin gamma, IgG, mouse monoclonal H&L chain clones or rabbit, goat polyclonal antibodies have 4 parts. There are 2 heavy chains, 2 light chains. The IgG antibody has 2 antigen binding sites. They represent 70% or more of serum antibodies. This antibody can be antigen purified or protein A or G purified. For storage sodium azide is added or you can call us to request azide free antibody preparations. These will need colder storage temperatures.

Test:

A high affinity purification column was use to purify Recombinant Mouse IgG Fc Receptor IV/FcgR4/CD16-2 (C-6His) by novo by chromatographic size exclusion.Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.

Additional description:

The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.